| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Virion infectivity factor |
|---|
| Ligand | BDBM272308 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | HIV Integrase Inhibitory Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 6.10±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Miyazaki, S; Bessho, Y; Adachi, K; Kawashita, S; Isoshima, H; Oshita, K; Fukuda, S Substituted thiazoles as HIV integrase inhibitors US Patent US10065950 Publication Date 9/4/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Virion infectivity factor |
|---|
| Name: | Virion infectivity factor |
|---|
| Synonyms: | HIV integrase | SOR | VIF_HV1N5 | Virion infectivity factor | inhibitory activity | vif |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22719.51 |
|---|
| Organism: | Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) |
|---|
| Description: | P12504 |
|---|
| Residue: | 192 |
|---|
| Sequence: | MENRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPKISSEVHIPLG
DAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPDLADQLIHLHYFDCFSESAI
RNTILGRIVSPRCEYQAGHNKVGSLQYLALAALIKPKQIKPPLPSVRKLTEDRWNKPQKT
KGHRGSHTMNGH
|
|
|
|---|
| BDBM272308 |
|---|
| n/a |
|---|
| Name | BDBM272308 |
|---|
| Synonyms: | US10065950, Example 150 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22F2N4O4S |
|---|
| Mol. Mass. | 476.496 |
|---|
| SMILES | COC[C@@H]1Cn2cc(-c3nnc(Cc4ccc(F)c(F)c4)s3)c(=O)c(O)c2C(=O)N1C(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
