| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adrenergic alpha2 receptor |
|---|
| Ligand | BDBM82505 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_1672 |
|---|
| Citation |  Wardle, KA; Ellis, ES; Baxter, GS; Kennett, GA; Gaster, LM; Sanger, GJ The effects of SB 204070, a highly potent and selective 5-HT4 receptor antagonist, on guinea-pig distal colon. Br J Pharmacol112:789-94 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Adrenergic alpha2 receptor |
|---|
| Name: | Adrenergic alpha2 receptor |
|---|
| Synonyms: | Adrenergic alpha2 receptor | adrenergic Alpha2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11420.09 |
|---|
| Organism: | Mesocricetus auratus |
|---|
| Description: | Q60533 |
|---|
| Residue: | 104 |
|---|
| Sequence: | RATPYSLQETLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVA
TLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAI
|
|
|
|---|
| BDBM82505 |
|---|
| n/a |
|---|
| Name | BDBM82505 |
|---|
| Synonyms: | CAS_121881 | NSC_121881 | SB204070 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27ClN2O4 |
|---|
| Mol. Mass. | 382.882 |
|---|
| SMILES | CCCCN1CCC(COC(=O)c2cc(Cl)c(N)c3OCCOc23)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
