Reaction Details |
| Report a problem with these data |
Target | Adrenergic alpha2 receptor |
---|
Ligand | BDBM82505 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1000±n/a nM |
---|
Comments | PDSP_1672 |
---|
Citation | Wardle, KA; Ellis, ES; Baxter, GS; Kennett, GA; Gaster, LM; Sanger, GJ The effects of SB 204070, a highly potent and selective 5-HT4 receptor antagonist, on guinea-pig distal colon. Br J Pharmacol112:789-94 (1994) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Adrenergic alpha2 receptor |
---|
Name: | Adrenergic alpha2 receptor |
Synonyms: | Adrenergic alpha2 receptor | adrenergic Alpha2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11420.09 |
Organism: | Mesocricetus auratus |
Description: | Q60533 |
Residue: | 104 |
Sequence: | RATPYSLQETLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVA
TLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAI
|
|
|
BDBM82505 |
---|
n/a |
---|
Name | BDBM82505 |
Synonyms: | CAS_121881 | NSC_121881 | SB204070 |
Type | Small organic molecule |
Emp. Form. | C19H27ClN2O4 |
Mol. Mass. | 382.882 |
SMILES | CCCCN1CCC(COC(=O)c2cc(Cl)c(N)c3OCCOc23)CC1 |
Structure |
|