Reaction Details |
| Report a problem with these data |
Target | Beta-lactamase |
---|
Ligand | BDBM83232 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) |
---|
IC50 | 4695±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Beta-lactamase |
---|
Name: | Beta-lactamase |
Synonyms: | Beta lactamase |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 31513.38 |
Organism: | Pseudomonas aeruginosa |
Description: | gi_114881106 |
Residue: | 286 |
Sequence: | MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
|
|
|
BDBM83232 |
---|
n/a |
---|
Name | BDBM83232 |
Synonyms: | 4-N-benzyl-6-morpholin-4-yl-2-N-[[5-(4-nitrophenyl)furan-2-yl]methylideneamino]-1,3,5-triazine-2,4-diamine | 6-(4-morpholinyl)-N2-[[5-(4-nitrophenyl)-2-furanyl]methylideneamino]-N4-(phenylmethyl)-1,3,5-triazine-2,4-diamine | 6-morpholin-4-yl-N2-[[5-(4-nitrophenyl)furan-2-yl]methylideneamino]-N4-(phenylmethyl)-1,3,5-triazine-2,4-diamine | MLS000709332 | SMR000289999 | benzyl-[4-morpholino-6-[N'-[[5-(4-nitrophenyl)-2-furyl]methylene]hydrazino]-s-triazin-2-yl]amine | cid_3100109 |
Type | Small organic molecule |
Emp. Form. | C25H24N8O4 |
Mol. Mass. | 500.5093 |
SMILES | [O-][N+](=O)c1ccc(cc1)-c1ccc(CN=Nc2nc(NCc3ccccc3)nc(n2)N2CCOCC2)o1 |w:15.16| |
Structure |
|