| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase |
|---|
| Ligand | BDBM43465 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) |
|---|
| IC50 | 7828±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Beta-lactamase |
|---|
| Name: | Beta-lactamase |
|---|
| Synonyms: | Beta lactamase |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 31513.38 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | gi_114881106 |
|---|
| Residue: | 286 |
|---|
| Sequence: | MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
|
|
|
|---|
| BDBM43465 |
|---|
| n/a |
|---|
| Name | BDBM43465 |
|---|
| Synonyms: | (Z)-2,3-bis(chloranyl)-3-[(4-chlorophenyl)methylsulfinyl]-N-(6-methoxypyridin-3-yl)prop-2-enamide | (Z)-2,3-dichloro-3-(4-chlorobenzyl)sulfinyl-N-(6-methoxy-3-pyridyl)acrylamide | (Z)-2,3-dichloro-3-[(4-chlorophenyl)methylsulfinyl]-N-(6-methoxy-3-pyridinyl)-2-propenamide | (Z)-2,3-dichloro-3-[(4-chlorophenyl)methylsulfinyl]-N-(6-methoxypyridin-3-yl)prop-2-enamide | 2,3-dichloro-3-[(4-chlorobenzyl)sulfinyl]-N-(6-methoxy-3-pyridinyl)acrylamide | MLS000706843 | SMR000334340 | cid_1472220 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13Cl3N2O3S |
|---|
| Mol. Mass. | 419.71 |
|---|
| SMILES | COc1ccc(NC(=O)C(Cl)=C(Cl)S(=O)Cc2ccc(Cl)cc2)cn1 |w:11.11| |
|---|
| Structure | 
|
|---|
Search and Browse
