Reaction Details |
| Report a problem with these data |
Target | Orotidine 5'-phosphate decarboxylase |
---|
Ligand | BDBM67847 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Luminescence-based cell-based high throughput dose response assay for activators of the GAA850 frataxin (FXN) promoter |
---|
EC50 | >59630±n/a nM |
---|
Citation | PubChem, PC Luminescence-based cell-based high throughput dose response assay for activators of the GAA850 frataxin (FXN) promoter PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Orotidine 5'-phosphate decarboxylase |
---|
Name: | Orotidine 5'-phosphate decarboxylase |
Synonyms: | FXN frataxin | PYRF_ASPNG | pyrA | pyrG |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 30195.13 |
Organism: | Aspergillus niger |
Description: | gi_2395 |
Residue: | 277 |
Sequence: | MSSKSQLTYTARASKHPNALAKRLFEIAEAKKTNVTVSADVTTTKELLDLADRLGPYIAV
IKTHIDILSDFSDETIEGLKALAQKHNFLIFEDRKFIDIGNTVQKQYHRGTLRISEWAHI
INCSILPGEGIVEALAQTASAPDFSYGPERGLLILAEMTSKGSLATGQYTTSSVDYARKY
KNFVMGFVSTRSLGEVQSEVSSPSDEEDFVVFTTGVNISSKGDKLGQQYQTPASAIGRGA
DFIIAGRGIYAAPDPVQAAQQYQKEGWEAYLARVGGN
|
|
|
BDBM67847 |
---|
n/a |
---|
Name | BDBM67847 |
Synonyms: | 4-(4-Chloro-phenyl)-5-cyano-2-methyl-6-(thiazol-2-ylcarbamoylmethylsulfanyl)-1,4-dihydro-pyridine-3-ca rboxylic acid allyl ester | 4-(4-chlorophenyl)-5-cyano-2-methyl-6-[[2-oxo-2-(2-thiazolylamino)ethyl]thio]-1,4-dihydropyridine-3-carboxylic acid prop-2-enyl ester | 4-(4-chlorophenyl)-5-cyano-6-[[2-keto-2-(thiazol-2-ylamino)ethyl]thio]-2-methyl-1,4-dihydropyridine-3-carboxylic acid allyl ester | MLS000555475 | SMR000147192 | cid_3409527 | prop-2-enyl 4-(4-chlorophenyl)-5-cyano-2-methyl-6-[2-oxidanylidene-2-(1,3-thiazol-2-ylamino)ethyl]sulfanyl-1,4-dihydropyridine-3-carboxylate | prop-2-enyl 4-(4-chlorophenyl)-5-cyano-2-methyl-6-[2-oxo-2-(1,3-thiazol-2-ylamino)ethyl]sulfanyl-1,4-dihydropyridine-3-carboxylate |
Type | Small organic molecule |
Emp. Form. | C22H19ClN4O3S2 |
Mol. Mass. | 486.994 |
SMILES | CC1=C(C(C(C#N)C(SCC(=O)Nc2nccs2)=N1)c1ccc(Cl)cc1)C(=O)OCC=C |c:18,t:1| |
Structure |
|