Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244183
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673166
Ki 1.2±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244183
n/a
NameBDBM50244183
Synonyms:CHEMBL4104170
TypeSmall organic molecule
Emp. Form.C36H36Cl2N4O4
Mol. Mass.659.601
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(CCCn3c12)c1ccc(cc1)C(O)=O |(55.31,-43.87,;53.85,-43.4,;53.37,-41.94,;51.83,-41.94,;50.92,-40.7,;51.35,-43.41,;49.89,-43.89,;52.6,-44.31,;52.61,-45.86,;51.28,-46.63,;49.95,-45.86,;51.28,-48.17,;52.61,-48.94,;53.95,-48.17,;55.42,-48.65,;55.9,-50.11,;57.41,-50.43,;57.88,-51.9,;59.39,-52.22,;59.86,-53.68,;61.36,-54,;61.84,-55.45,;63.35,-55.77,;60.81,-56.61,;61.29,-58.07,;59.31,-56.29,;58.27,-57.43,;58.83,-54.82,;56.33,-47.39,;57.89,-47.46,;58.5,-48.87,;58.91,-46.28,;58.62,-44.75,;57.25,-44.01,;55.83,-44.64,;55.42,-46.14,;53.95,-46.62,;60.4,-46.68,;60.78,-48.17,;62.27,-48.57,;63.36,-47.48,;62.96,-45.98,;61.47,-45.59,;64.85,-47.88,;65.94,-46.79,;65.25,-49.37,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: