Reaction Details |
| Report a problem with these data |
Target | Peroxisome proliferator-activated receptor delta |
---|
Ligand | BDBM50244350 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1673607 (CHEMBL4023636) |
---|
EC50 | 1560±n/a nM |
---|
Citation | Boubia, B; Poupardin, O; Barth, M; Binet, J; Peralba, P; Mounier, L; Jacquier, E; Gauthier, E; Lepais, V; Chatar, M; Ferry, S; Thourigny, A; Guillier, F; Llacer, J; Amaudrut, J; Dodey, P; Lacombe, O; Masson, P; Montalbetti, C; Wettstein, G; Luccarini, JM; Legendre, C; Junien, JL; Broqua, P Design, Synthesis, and Evaluation of a Novel Series of Indole Sulfonamide Peroxisome Proliferator Activated Receptor (PPAR)?/?/? Triple Activators: Discovery of Lanifibranor, a New Antifibrotic Clinical Candidate. J Med Chem61:2246-2265 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peroxisome proliferator-activated receptor delta |
---|
Name: | Peroxisome proliferator-activated receptor delta |
Synonyms: | NUC1 | Nr1c2 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta | PPARD_MOUSE | Pparb | Ppard |
Type: | PROTEIN |
Mol. Mass.: | 49719.14 |
Organism: | Mus musculus |
Description: | ChEMBL_1288931 |
Residue: | 440 |
Sequence: | MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
|
|
|
BDBM50244350 |
---|
n/a |
---|
Name | BDBM50244350 |
Synonyms: | CHEMBL4091374 |
Type | Small organic molecule |
Emp. Form. | C19H15ClN2O4S2 |
Mol. Mass. | 434.916 |
SMILES | OC(=O)CCCc1cc2cc(Cl)ccc2n1S(=O)(=O)c1ccc2ncsc2c1 |
Structure |
|