| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50004597 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159622 |
|---|
| IC50 | >63000±n/a nM |
|---|
| Citation |  Humber, DC; Cammack, N; Coates, JA; Cobley, KN; Orr, DC; Storer, R; Weingarten, GG; Weir, MP Penicillin derived C2-symmetric dimers as novel inhibitors of HIV-1 proteinase. J Med Chem35:3080-1 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50004597 |
|---|
| n/a |
|---|
| Name | BDBM50004597 |
|---|
| Synonyms: | (4-Ethylcarbamoyl-5,5-dimethyl-thiazolidin-2-yl)-phenylacetylamino-acetic acid methyl ester | CHEMBL321096 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27N3O4S |
|---|
| Mol. Mass. | 393.5 |
|---|
| SMILES | CCNC(=O)[C@@H]1N[C@H](SC1(C)C)[C@H](NC(=O)Cc1ccccc1)C(=O)OC |
|---|
| Structure | 
|
|---|
Search and Browse
