Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM590 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_159622 |
---|
IC50 | 4.8±n/a nM |
---|
Citation | Humber, DC; Cammack, N; Coates, JA; Cobley, KN; Orr, DC; Storer, R; Weingarten, GG; Weir, MP Penicillin derived C2-symmetric dimers as novel inhibitors of HIV-1 proteinase. J Med Chem35:3080-1 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM590 |
---|
n/a |
---|
Name | BDBM590 |
Synonyms: | (2R,4S)-2-[(R)-(ethylcarbamoyl)(1-phenylacetamido)methyl]-N-(2-{[(2R,4S)-2-[(R)-(ethylcarbamoyl)(1-phenylacetamido)methyl]-5,5-dimethyl-1,3-thiazolidin-4-yl]formamido}ethyl)-5,5-dimethyl-1,3-thiazolidine-4-carboxamide | CHEMBL105851 | [2R-[2a(R*),4B]]-4,4 -[ 1,2-Ethanediylbis[ aminocarbonyl]]-bis[N-ethyl-5,5-dimethyl-a-[ (phenylacetyl)amino]-2-thiazolidineacetamide] | penicillin Et(NH)2 Sym dimmer | penicillin deriv. 3 |
Type | Small organic molecule |
Emp. Form. | C38H54N8O6S2 |
Mol. Mass. | 783.015 |
SMILES | [H][C@]1(N[C@@H](C(=O)NCCNC(=O)[C@@H]2N[C@]([H])(SC2(C)C)[C@H](NC(=O)Cc2ccccc2)C(=O)NCC)C(C)(C)S1)[C@H](NC(=O)Cc1ccccc1)C(=O)NCC |r| |
Structure |
|