Reaction Details |
| Report a problem with these data |
Target | Thymidylate synthase |
---|
Ligand | BDBM50005331 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_208947 |
---|
Ki | 350±n/a nM |
---|
Citation | Reich, SH; Fuhry, MA; Nguyen, D; Pino, MJ; Welsh, KM; Webber, S; Janson, CA; Jordan, SR; Matthews, DA; Smith, WW Design and synthesis of novel 6,7-imidazotetrahydroquinoline inhibitors of thymidylate synthase using iterative protein crystal structure analysis. J Med Chem35:847-58 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thymidylate synthase |
---|
Name: | Thymidylate synthase |
Synonyms: | TS | TSase | Thymidylate Synthase (TS) | Thymidylate synthase | thyA |
Type: | n/a |
Mol. Mass.: | 30487.86 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 264 |
Sequence: | MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWIGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF
DYRFEDFEIEGYDPHPGIKAPVAI
|
|
|
BDBM50005331 |
---|
n/a |
---|
Name | BDBM50005331 |
Synonyms: | 5-(4-Benzenesulfonyl-phenylsulfanyl)-5,6,7,8-tetrahydro-1H-naphtho[2,3-d]imidazol-2-ylamine | CHEMBL353191 |
Type | Small organic molecule |
Emp. Form. | C23H21N3O2S2 |
Mol. Mass. | 435.562 |
SMILES | Nc1nc2cc3CCCC(Sc4ccc(cc4)S(=O)(=O)c4ccccc4)c3cc2[nH]1 |
Structure |
|