| Reaction Details |
|---|
 | Report a problem with these data |
| Target | NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|
| Ligand | BDBM50041802 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1687482 |
|---|
| IC50 | 453400±n/a nM |
|---|
| Citation |  Kalbas, D; Liebscher, S; Nowak, T; Meleshin, M; Pannek, M; Popp, C; Alhalabi, Z; Bordusa, F; Sippl, W; Steegborn, C; Schutkowski, M Potent and Selective Inhibitors of Human Sirtuin 5. J Med Chem61:2460-2471 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|
| Name: | NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|
| Synonyms: | NAD-dependent protein deacetylase sirtuin-5 (SIRT5) | NAD-dependent protein deacylase sirtuin-5, mitochondrial | Regulatory protein SIR2 homolog 5 | SIR2-like protein 5 | SIR2L5 | SIR5_HUMAN | SIRT5 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 33892.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9NXA8 |
|---|
| Residue: | 310 |
|---|
| Sequence: | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAG
VSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRA
IAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
CPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELA
HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA
LACHENETVS
|
|
|
|---|
| BDBM50041802 |
|---|
| n/a |
|---|
| Name | BDBM50041802 |
|---|
| Synonyms: | 1,8-dihydroxy-9(10H)-anthracenone | 1,8-dihydroxy-9-anthrone | 1,8-dihydroxyanthracen-9(10H)-one | 1,8-dihydroxyanthrone | CHEMBL46469 | US9182402, 15 | anthralin | cid_2202 | dithranol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H10O3 |
|---|
| Mol. Mass. | 226.2274 |
|---|
| SMILES | Oc1cccc2Cc3cccc(O)c3C(=O)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
