Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride lipase
LigandBDBM50255777
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1687487
IC50 24±n/a nM
Citation McAllister LAButler CRMente SO'Neil SVFonseca KRPiro JRCianfrogna JAFoley TLGilbert AMHarris ARHelal CJJohnson DSMontgomery JINason DMNoell SPandit JRogers BNSamad TAShaffer CLda Silva RGUccello DPWebb DBrodney MA Discovery of Trifluoromethyl Glycol Carbamates as Potent and Selective Covalent Monoacylglycerol Lipase (MAGL) Inhibitors for Treatment of Neuroinflammation. J Med Chem 61:3008-3026 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoglyceride lipase
Name:Monoglyceride lipase
Synonyms:HU-K5 | Lysophospholipase homolog | Lysophospholipase-like | MAGL | MGL | MGLL
Type:Hydrolase
Mol. Mass.:33264.56
Organism:Homo sapiens (Human)
Description:Human recombinant MGL (Cayman Chemical, cat# 10008354).
Residue:303
Sequence:
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50255777
n/a
NameBDBM50255777
Synonyms:CHEMBL4061795
TypeSmall organic molecule
Emp. Form.C21H17FN4O4
Mol. Mass.408.3825
SMILES[H][C@@]12CN(C[C@]1([H])[C@H]2c1ccn(n1)-c1ccc(F)cc1)C(=O)Oc1ccc(cc1)[N+]([O-])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: