| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Ligand | BDBM50256251 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1687628 |
|---|
| Kd | 9.0±n/a nM |
|---|
| Citation |  Chen, L; Zhuang, C; Lu, J; Jiang, Y; Sheng, C Discovery of Novel KRAS-PDE? Inhibitors by Fragment-Based Drug Design. J Med Chem61:2604-2610 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Name: | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Synonyms: | 3',5'-cyclic phosphodiesterase | GMP-PDE delta | PDE6D | PDE6D_HUMAN | PDED | Protein p17 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17418.30 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_105761 |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
|
|
|
|---|
| BDBM50256251 |
|---|
| n/a |
|---|
| Name | BDBM50256251 |
|---|
| Synonyms: | CHEMBL4100698 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H28FN5O2 |
|---|
| Mol. Mass. | 569.6275 |
|---|
| SMILES | Fc1ccccc1C1Nc2ccccc2C(=O)N1CCOc1ccc(cc1)-c1nc2ccccc2n1Cc1ccncc1 |
|---|
| Structure | 
|
|---|
Search and Browse
