| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 [K65Q] |
|---|
| Ligand | BDBM16314 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_31339 |
|---|
| IC50 | 34±n/a nM |
|---|
| Citation |  Wrobel, J; Millen, J; Sredy, J; Dietrich, A; Gorham, BJ; Malamas, M; Kelly, JM; Bauman, JG; Harrison, MC; Jones, LR Syntheses of tolrestat analogues containing additional substituents in the ring and their evaluation as aldose reductase inhibitors. Identification of potent, orally active 2-fluoro derivatives. J Med Chem34:2504-20 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 [K65Q] |
|---|
| Name: | Aldo-keto reductase family 1 member B1 [K65Q] |
|---|
| Synonyms: | AKR1B1 | ALDR_BOVIN | Aldose reductase |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35916.27 |
|---|
| Organism: | Bos taurus (Cattle) |
|---|
| Description: | P16116[K65Q] |
|---|
| Residue: | 315 |
|---|
| Sequence: | AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQA
KLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKD
FFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA
VNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKY
NKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACAL
VSCASHRDYPFHEEF
|
|
|
|---|
| BDBM16314 |
|---|
| n/a |
|---|
| Name | BDBM16314 |
|---|
| Synonyms: | 2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid | Alredase | CHEMBL436 | N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine | Tolrestat |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H14F3NO3S |
|---|
| Mol. Mass. | 357.347 |
|---|
| SMILES | COc1ccc2c(cccc2c1C(F)(F)F)C(=S)N(C)CC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
