Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 [K65Q] |
---|
Ligand | BDBM16314 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_31339 |
---|
IC50 | 34±n/a nM |
---|
Citation | Wrobel, J; Millen, J; Sredy, J; Dietrich, A; Gorham, BJ; Malamas, M; Kelly, JM; Bauman, JG; Harrison, MC; Jones, LR Syntheses of tolrestat analogues containing additional substituents in the ring and their evaluation as aldose reductase inhibitors. Identification of potent, orally active 2-fluoro derivatives. J Med Chem34:2504-20 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 [K65Q] |
---|
Name: | Aldo-keto reductase family 1 member B1 [K65Q] |
Synonyms: | AKR1B1 | ALDR_BOVIN | Aldose reductase |
Type: | Protein |
Mol. Mass.: | 35916.27 |
Organism: | Bos taurus (Cattle) |
Description: | P16116[K65Q] |
Residue: | 315 |
Sequence: | AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQA
KLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKD
FFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA
VNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKY
NKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACAL
VSCASHRDYPFHEEF
|
|
|
BDBM16314 |
---|
n/a |
---|
Name | BDBM16314 |
Synonyms: | 2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid | Alredase | CHEMBL436 | N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine | Tolrestat |
Type | Small organic molecule |
Emp. Form. | C16H14F3NO3S |
Mol. Mass. | 357.347 |
SMILES | COc1ccc2c(cccc2c1C(F)(F)F)C(=S)N(C)CC(O)=O |
Structure |
|