| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM50266545 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1700964 (CHEMBL4051946) |
|---|
| EC50 | 238±n/a nM |
|---|
| Citation |  Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J Topical Intestinal Aminoimidazole Agonists of G-Protein-Coupled Bile Acid Receptor 1 Promote Glucagon Like Peptide-1 Secretion and Improve Glucose Tolerance. J Med Chem60:4185-4211 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 35260.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | CHO cells transiently transfected with hTGR5. |
|---|
| Residue: | 330 |
|---|
| Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
|---|
| BDBM50266545 |
|---|
| n/a |
|---|
| Name | BDBM50266545 |
|---|
| Synonyms: | CHEMBL4078612 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H40F3N5O5S |
|---|
| Mol. Mass. | 699.783 |
|---|
| SMILES | [O-]C=O.COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(OCCC[N+]34CCN(CC3)CC4)cc2F)n1-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
