| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM50272009 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1711749 (CHEMBL4121798) |
|---|
| EC50 | 1.6±n/a nM |
|---|
| Citation |  Agarwal, S; Sasane, S; Kumar, J; Deshmukh, P; Bhayani, H; Giri, P; Giri, S; Soman, S; Kulkarni, N; Jain, M Evaluation of novel TGR5 agonist in combination with Sitagliptin for possible treatment of type 2 diabetes. Bioorg Med Chem Lett28:1849-1852 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 35260.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | CHO cells transiently transfected with hTGR5. |
|---|
| Residue: | 330 |
|---|
| Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
|---|
| BDBM50272009 |
|---|
| n/a |
|---|
| Name | BDBM50272009 |
|---|
| Synonyms: | CHEMBL4126062 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H29ClF2N2O3S |
|---|
| Mol. Mass. | 559.067 |
|---|
| SMILES | COc1ccc(cc1OC)C(C)(C)c1cnc(SCCOCc2c(F)cccc2Cl)n1-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
