Reaction Details |
| Report a problem with these data |
Target | Cysteinyl leukotriene receptor 1 |
---|
Ligand | BDBM50013919 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52377 (CHEMBL663210) |
---|
IC50 | 3.1±n/a nM |
---|
Citation | Gauthier, JY; Jones, T; Champion, E; Charette, L; Dehaven, R; Ford-Hutchinson, AW; Hoogsteen, K; Lord, A; Masson, P; Piechuta, H Stereospecific synthesis, assignment of absolute configuration, and biological activity of the enantiomers of 3-[[[3-[2-(7-chloroquinolin-2-yl)-(E)-ethenyl]phenyl] [[3-(dimethylamino)-3-oxopropyl]thio]methyl]thio]propionic acid, a potent and specific leukotriene D4 receptor antagonist. J Med Chem33:2841-5 (1990) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cysteinyl leukotriene receptor 1 |
---|
Name: | Cysteinyl leukotriene receptor 1 |
Synonyms: | CLTR1_HUMAN | CYSLT1 | CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | Cysteinyl leukotriene receptor 1 | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 38565.16 |
Organism: | Homo sapiens (Human) |
Description: | Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271 |
Residue: | 337 |
Sequence: | MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
|
|
|
BDBM50013919 |
---|
n/a |
---|
Name | BDBM50013919 |
Synonyms: | 3-[{3-[2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid | CHEMBL97257 |
Type | Small organic molecule |
Emp. Form. | C26H27ClN2O3S2 |
Mol. Mass. | 515.087 |
SMILES | CN(C)C(=O)CCS[C@@H](SCCC(O)=O)c1cccc(\C=C\c2ccc3ccc(Cl)cc3n2)c1 |
Structure |
|