Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50014149 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159470 (CHEMBL769256) |
---|
IC50 | 0.380000±n/a nM |
---|
Citation | Kempf, DJ; Norbeck, DW; Codacovi, L; Wang, XC; Kohlbrenner, WE; Wideburg, NE; Paul, DA; Knigge, MF; Vasavanonda, S; Craig-Kennard, A Structure-based, C2 symmetric inhibitors of HIV protease. J Med Chem33:2687-9 (1990) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50014149 |
---|
n/a |
---|
Name | BDBM50014149 |
Synonyms: | CHEMBL314758 | {1-[1-Benzyl-4-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-2,3-dihydroxy-5-phenyl-pentylcarbamoyl]-2-methyl-propyl}-carbamic acid benzyl ester |
Type | Small organic molecule |
Emp. Form. | C44H54N4O8 |
Mol. Mass. | 766.9216 |
SMILES | CC(C)[C@H](NC(=O)OCc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)[C@H](O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](NC(=O)OCc1ccccc1)C(C)C |
Structure |
|