| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50274733 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1714218 (CHEMBL4124267) |
|---|
| IC50 | 3.5±n/a nM |
|---|
| Citation |  Willemse, T; Eiselt, E; Hollanders, K; Schepens, W; van Vlijmen, HWT; Chung, NN; Blais, V; Holleran, B; Longpré, JM; Schiller, PW; Maes, BUW; Sarret, P; Gendron, L; Ballet, S Chemical space screening around Phe Bioorg Med Chem Lett28:2320-2323 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50274733 |
|---|
| n/a |
|---|
| Name | BDBM50274733 |
|---|
| Synonyms: | CHEMBL4127080 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H44N8O5 |
|---|
| Mol. Mass. | 644.7638 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N[C@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccccc1-c1ccccc1)C(=O)NCC(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
