| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50274679 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1714221 (CHEMBL4124270) |
|---|
| EC50 | 4.4±n/a nM |
|---|
| Citation |  Willemse, T; Eiselt, E; Hollanders, K; Schepens, W; van Vlijmen, HWT; Chung, NN; Blais, V; Holleran, B; Longpré, JM; Schiller, PW; Maes, BUW; Sarret, P; Gendron, L; Ballet, S Chemical space screening around Phe Bioorg Med Chem Lett28:2320-2323 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50274679 |
|---|
| n/a |
|---|
| Name | BDBM50274679 |
|---|
| Synonyms: | CHEMBL4128530 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H37N5O5 |
|---|
| Mol. Mass. | 523.6239 |
|---|
| SMILES | C[C@@H](NC(=O)[C@@H](N)Cc1c(C)cc(O)cc1C)C(=O)N(C)[C@@H](Cc1ccccc1C=C)C(=O)NCC(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
