Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetElastase 1
LigandBDBM50014738
Substrate/Competitorn/a
Meas. Tech.ChEBML_63628
Ki 0.580000±n/a nM
Citation Peet NPBurkhart JPAngelastro MRGiroux ELMehdi SBey PKolb MNeises BSchirlin D Synthesis of peptidyl fluoromethyl ketones and peptidyl alpha-keto esters as inhibitors of porcine pancreatic elastase, human neutrophil elastase, and rat and human neutrophil cathepsin G. J Med Chem 33:394-407 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Elastase 1
Name:Elastase 1
Synonyms:Elastase-1
Type:PROTEIN
Mol. Mass.:27805.35
Organism:Homo sapiens (Human)
Description:ChEMBL_63626
Residue:258
Sequence:
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMT
AAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQS
VTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSS
YWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTV
FTQVSAYISWINNVIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014738
n/a
NameBDBM50014738
Synonyms:CHEMBL130253 | N-(Adamantyl-sulfonyl)-N-(methoxy succinate) lys-pro-val-trifluromethane
TypeSmall organic molecule
Emp. Form.C32H49F3N4O8S
Mol. Mass.706.814
SMILESCOC(=O)CCC(=O)NCCCC[C@H](NS(=O)(=O)C12CC3CC(CC(C3)C1)C2)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)C(F)(F)F |TLB:25:24:27:19.20.21,25:20:27:26.24.23,THB:23:22:19:26.24.25,23:24:19:27.22.21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: