| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50014936 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54604 |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  DeGraw, JI; Christie, PH; Kisliuk, RL; Gaumont, Y; Sirotnak, FM Synthesis and antifolate properties of 10-alkyl-5,10-dideaza analogues of methotrexate and tetrahydrofolic acid. J Med Chem33:673-7 (1990) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50014936 |
|---|
| n/a |
|---|
| Name | BDBM50014936 |
|---|
| Synonyms: | 2-{4-[1-(2-Amino-4-hydroxy-5,6,7,8-tetrahydro-pyrido[2,3-d]pyrimidin-6-ylmethyl)-propyl]-benzoylamino}-pentanedioic acid | CHEMBL162414 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29N5O6 |
|---|
| Mol. Mass. | 471.5063 |
|---|
| SMILES | CCC(CC1CNc2nc(N)[nH]c(=O)c2C1)c1ccc(cc1)C(=O)NC(CCC(O)=O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
