| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50015857 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_216458 (CHEMBL818529) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Doherty, JB; Ashe, BM; Barker, PL; Blacklock, TJ; Butcher, JW; Chandler, GO; Dahlgren, ME; Davies, P; Dorn, CP; Finke, PE Inhibition of human leukocyte elastase. 1. Inhibition by C-7-substituted cephalosporin tert-butyl esters. J Med Chem33:2513-21 (1990) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50015857 |
|---|
| n/a |
|---|
| Name | BDBM50015857 |
|---|
| Synonyms: | 3-Acetoxymethyl-5,5,8-trioxo-7-phenylacetoxy-5lambda*6*-thia-1-aza-bicyclo[4.2.0]oct-2-ene-2-carboxylic acid tert-butyl ester | CHEMBL421718 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25NO9S |
|---|
| Mol. Mass. | 479.5 |
|---|
| SMILES | CC(=O)OCC1=C(N2[C@@H]([C@@H](OC(=O)Cc3ccccc3)C2=O)S(=O)(=O)C1)C(=O)OC(C)(C)C |t:5| |
|---|
| Structure | 
|
|---|
Search and Browse
