| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 5A, mitochondrial |
|---|
| Ligand | BDBM50341391 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1734317 (CHEMBL4149853) |
|---|
| Ki | 4.0±n/a nM |
|---|
| Citation |  Angeli, A; di Cesare Mannelli, L; Trallori, E; Peat, TS; Ghelardini, C; Carta, F; Supuran, CT Design, Synthesis, and X-ray of Selenides as New Class of Agents for Prevention of Diabetic Cerebrovascular Pathology. ACS Med Chem Lett9:462-467 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 5A, mitochondrial |
|---|
| Name: | Carbonic anhydrase 5A, mitochondrial |
|---|
| Synonyms: | CA-VA | CA5 | CA5A | CAH5A_HUMAN | Carbonate dehydratase VA | Carbonic Anhydrase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VA (CA VA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34755.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human (cloned) isozyme |
|---|
| Residue: | 305 |
|---|
| Sequence: | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
|
|
|
|---|
| BDBM50341391 |
|---|
| n/a |
|---|
| Name | BDBM50341391 |
|---|
| Synonyms: | CHEMBL4163634 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H13NO3SSe |
|---|
| Mol. Mass. | 294.23 |
|---|
| SMILES | [#6]-[#8]-[#6]-[#6][Se;v2]c1ccc(cc1)S([#7])(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
