| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM50332017 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1734432 (CHEMBL4149968) |
|---|
| Kd | >2000000±n/a nM |
|---|
| Citation |  Vulpetti, A; Ostermann, N; Randl, S; Yoon, T; Mac Sweeney, A; Cumin, F; Lorthiois, E; Rüdisser, S; Erbel, P; Maibaum, J Discovery and Design of First Benzylamine-Based Ligands Binding to an Unlocked Conformation of the Complement Factor D. ACS Med Chem Lett9:490-495 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM50332017 |
|---|
| n/a |
|---|
| Name | BDBM50332017 |
|---|
| Synonyms: | CHEMBL4165382 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N4O2 |
|---|
| Mol. Mass. | 352.4302 |
|---|
| SMILES | NC(=O)c1cc2c(NC(=O)C34CC5CC(CC(N)(C5)C3)C4)cccc2[nH]1 |TLB:20:10:18:13.14.15,8:10:18:13.14.15,17:16:11:13.20.14,THB:20:14:11.10.19:18,15:14:11:19.16.18,15:16:11:13.20.14| |
|---|
| Structure | 
|
|---|
Search and Browse
