Reaction Details |
| Report a problem with these data |
Target | Complement factor D |
---|
Ligand | BDBM50333119 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1734433 (CHEMBL4149969) |
---|
Kd | 120000±n/a nM |
---|
Citation | Vulpetti, A; Ostermann, N; Randl, S; Yoon, T; Mac Sweeney, A; Cumin, F; Lorthiois, E; Rüdisser, S; Erbel, P; Maibaum, J Discovery and Design of First Benzylamine-Based Ligands Binding to an Unlocked Conformation of the Complement Factor D. ACS Med Chem Lett9:490-495 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D |
---|
Name: | Complement factor D |
Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
Type: | Protein |
Mol. Mass.: | 27039.19 |
Organism: | Homo sapiens (Human) |
Description: | P00746 |
Residue: | 253 |
Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
BDBM50333119 |
---|
n/a |
---|
Name | BDBM50333119 |
Synonyms: | CHEMBL4170258 |
Type | Small organic molecule |
Emp. Form. | C18H22N2O |
Mol. Mass. | 282.3801 |
SMILES | CC(C)CC(=O)Nc1cccc(c1)-c1cccc(CN)c1 |
Structure |
|