| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Group 10 secretory phospholipase A2 |
|---|
| Ligand | BDBM50366784 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1735583 (CHEMBL4151119) |
|---|
| IC50 | 96±n/a nM |
|---|
| Citation |  Knerr, L; Giordanetto, F; Nordberg, P; Pettersen, D; Selmi, N; Beisel, HG; de la Motte, H; Olsson, T; Perkins, TDJ; Herslöf, M; Månsson, Å; Dahlström, M; Starke, I; Broddefalk, J; Saarinen, G; Klingegård, F; Hurt-Camejo, E; Rosengren, B; Brengdahl, J; Jansen, F; Rohman, M; Sandmark, J; Hallberg, K; Åkerud, T; Roth, RG; Ahlqvist, M Discovery of a Series of Indole-2 Carboxamides as Selective Secreted Phospholipase A ACS Med Chem Lett9:594-599 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Group 10 secretory phospholipase A2 |
|---|
| Name: | Group 10 secretory phospholipase A2 |
|---|
| Synonyms: | Group X secretory phospholipase A2 | PA2GX_MOUSE | Pla2g10 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17005.09 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_537139 |
|---|
| Residue: | 151 |
|---|
| Sequence: | MLLLLLLLLLGPGPGFSEATRRSHVYKRGLLELAGTLDCVGPRSPMAYMNYGCYCGLGGH
GEPRDAIDWCCYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGPAENKCQELLCRCDE
ELAYCLAGTEYHLKYLFFPSILCEKDSPKCN
|
|
|
|---|
| BDBM50366784 |
|---|
| n/a |
|---|
| Name | BDBM50366784 |
|---|
| Synonyms: | CHEMBL4171084 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H15F3N2O4 |
|---|
| Mol. Mass. | 392.3286 |
|---|
| SMILES | NC(=O)c1cc2ccc(OC(F)(F)F)cc2n1-c1cccc(CCC(O)=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
