Reaction Details |
| Report a problem with these data |
Target | Free fatty acid receptor 2 |
---|
Ligand | BDBM50450289 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1742527 (CHEMBL4158277) |
---|
EC50 | 50±n/a nM |
---|
Citation | Hoveyda, HR; Fraser, GL; Zoute, L; Dutheuil, G; Schils, D; Brantis, C; Lapin, A; Parcq, J; Guitard, S; Lenoir, F; Bousmaqui, ME; Rorive, S; Hospied, S; Blanc, S; Bernard, J; Ooms, F; McNelis, JC; Olefsky, JM N-Thiazolylamide-based free fatty-acid 2 receptor agonists: Discovery, lead optimization and demonstration of off-target effect in a diabetes model. Bioorg Med Chem26:5169-5180 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 2 |
---|
Name: | Free fatty acid receptor 2 |
Synonyms: | FFAR2_MOUSE | Ffar2 | G-protein coupled receptor 43 | Gpr43 | Leukocyte-specific STAT-induced GPCR | Lssig |
Type: | PROTEIN |
Mol. Mass.: | 37133.99 |
Organism: | Mus musculus |
Description: | ChEMBL_109188 |
Residue: | 330 |
Sequence: | MTPDWHSSLILTAYILIFLTGLPANLLALRAFMGRVRQPQPAPVHILLLNLTLADLLLLL
LLPFRIVEAASNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISMERYLGVAFPVQYKLS
RRPLYGVIAALVAWIMSFGHCTIVIIVQYLNSTEQVGTENQITCYENFTQEQLDVVLPVR
LELCLVLFFVPMAVTIFCYWRFVWIMLTQPHVGAQRRRRAVGLAVVTLLNFLVCFGPYNM
SHLVGFYLRQSPSWRVEAVVFSSLNASLDPLLFYFSSSVVRRAFGKGLLLIRNPASSMLG
RGAKETVEGTKMDRGGSQAEGVQSSEFVTE
|
|
|
BDBM50450289 |
---|
n/a |
---|
Name | BDBM50450289 |
Synonyms: | CHEMBL4172928 |
Type | Small organic molecule |
Emp. Form. | C23H20Cl2N2O3S |
Mol. Mass. | 475.388 |
SMILES | OC(=O)C[C@@H](Cc1ccccc1)C(=O)N(C1CC1)c1nc(cs1)-c1cc(Cl)ccc1Cl |r| |
Structure |
|