| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 2 |
|---|
| Ligand | BDBM50450436 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1742527 (CHEMBL4158277) |
|---|
| EC50 | 79±n/a nM |
|---|
| Citation |  Hoveyda, HR; Fraser, GL; Zoute, L; Dutheuil, G; Schils, D; Brantis, C; Lapin, A; Parcq, J; Guitard, S; Lenoir, F; Bousmaqui, ME; Rorive, S; Hospied, S; Blanc, S; Bernard, J; Ooms, F; McNelis, JC; Olefsky, JM N-Thiazolylamide-based free fatty-acid 2 receptor agonists: Discovery, lead optimization and demonstration of off-target effect in a diabetes model. Bioorg Med Chem26:5169-5180 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 2 |
|---|
| Name: | Free fatty acid receptor 2 |
|---|
| Synonyms: | FFAR2_MOUSE | Ffar2 | G-protein coupled receptor 43 | Gpr43 | Leukocyte-specific STAT-induced GPCR | Lssig |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37133.99 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_109188 |
|---|
| Residue: | 330 |
|---|
| Sequence: | MTPDWHSSLILTAYILIFLTGLPANLLALRAFMGRVRQPQPAPVHILLLNLTLADLLLLL
LLPFRIVEAASNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISMERYLGVAFPVQYKLS
RRPLYGVIAALVAWIMSFGHCTIVIIVQYLNSTEQVGTENQITCYENFTQEQLDVVLPVR
LELCLVLFFVPMAVTIFCYWRFVWIMLTQPHVGAQRRRRAVGLAVVTLLNFLVCFGPYNM
SHLVGFYLRQSPSWRVEAVVFSSLNASLDPLLFYFSSSVVRRAFGKGLLLIRNPASSMLG
RGAKETVEGTKMDRGGSQAEGVQSSEFVTE
|
|
|
|---|
| BDBM50450436 |
|---|
| n/a |
|---|
| Name | BDBM50450436 |
|---|
| Synonyms: | CHEMBL4173663 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H31N5O3S |
|---|
| Mol. Mass. | 541.664 |
|---|
| SMILES | OC(=O)C[C@@H](CC1CCCC1)C(=O)N(C1CC1)c1nc(cs1)-c1ccccc1-c1ccc(nc1)-n1cccn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
