| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 6 |
|---|
| Ligand | BDBM50455051 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1753762 (CHEMBL4188522) |
|---|
| IC50 | 16±n/a nM |
|---|
| Citation |  Wang, Y; Liu, WJ; Yin, L; Li, H; Chen, ZH; Zhu, DX; Song, XQ; Cheng, ZZ; Song, P; Wang, Z; Li, ZG Design and synthesis of 4-(2,3-dihydro-1H-benzo[d]pyrrolo[1,2-a]imidazol-7-yl)-N-(5-(piperazin-1-ylmethyl)pyridine-2-yl)pyrimidin-2-amine as a highly potent and selective cyclin-dependent kinases 4 and 6 inhibitors and the discovery of structure-activity relationships. Bioorg Med Chem Lett28:974-978 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 6 |
|---|
| Name: | Cyclin-dependent kinase 6 |
|---|
| Synonyms: | CDK6 | CDK6_HUMAN | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 36937.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00534 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
|
|
|
|---|
| BDBM50455051 |
|---|
| n/a |
|---|
| Name | BDBM50455051 |
|---|
| Synonyms: | CHEMBL4210028 | US10696678, Example 24 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H33FN8 |
|---|
| Mol. Mass. | 500.6136 |
|---|
| SMILES | CCN1CCN(Cc2ccc(Nc3ncc(F)c(n3)-c3ccc4nc5CCC(C)(C)n5c4c3)nc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
