Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 6 |
---|
Ligand | BDBM50455051 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1753762 (CHEMBL4188522) |
---|
IC50 | 16±n/a nM |
---|
Citation | Wang, Y; Liu, WJ; Yin, L; Li, H; Chen, ZH; Zhu, DX; Song, XQ; Cheng, ZZ; Song, P; Wang, Z; Li, ZG Design and synthesis of 4-(2,3-dihydro-1H-benzo[d]pyrrolo[1,2-a]imidazol-7-yl)-N-(5-(piperazin-1-ylmethyl)pyridine-2-yl)pyrimidin-2-amine as a highly potent and selective cyclin-dependent kinases 4 and 6 inhibitors and the discovery of structure-activity relationships. Bioorg Med Chem Lett28:974-978 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 6 |
---|
Name: | Cyclin-dependent kinase 6 |
Synonyms: | CDK6 | CDK6_HUMAN | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE |
Type: | Enzyme Subunit |
Mol. Mass.: | 36937.42 |
Organism: | Homo sapiens (Human) |
Description: | Q00534 |
Residue: | 326 |
Sequence: | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
|
|
|
BDBM50455051 |
---|
n/a |
---|
Name | BDBM50455051 |
Synonyms: | CHEMBL4210028 | US10696678, Example 24 |
Type | Small organic molecule |
Emp. Form. | C28H33FN8 |
Mol. Mass. | 500.6136 |
SMILES | CCN1CCN(Cc2ccc(Nc3ncc(F)c(n3)-c3ccc4nc5CCC(C)(C)n5c4c3)nc2)CC1 |
Structure |
|