| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50176702 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1758811 (CHEMBL4193819) |
|---|
| Ki | 5.3±n/a nM |
|---|
| Citation |  Stefanucci, A; Carotenuto, A; Macedonio, G; Novellino, E; Pieretti, S; Marzoli, F; Sz?cs, E; Erdei, AI; Zádor, F; Benyhe, S; Mollica, A Cyclic Biphalin Analogues Incorporating a Xylene Bridge: Synthesis, Characterization, and Biological Profile. ACS Med Chem Lett8:858-863 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50176702 |
|---|
| n/a |
|---|
| Name | BDBM50176702 |
|---|
| Synonyms: | (S)-2-amino-N-{(4S,10S,15S,21S)-21-[(S)-2-amino-3-(4-hydroxy-phenyl)-propionylamino]-10,15-dibenzyl-5,8,11,14,17,20-hexaoxo-1,2-dithia-6,9,12,13,16,19-hexaaza-cyclodocos-4-yl}-3-(4-hydroxy-phenyl)-propionamide | CHEMBL200129 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H54N10O10S2 |
|---|
| Mol. Mass. | 971.112 |
|---|
| SMILES | N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H]1CSSC[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)NCC(=O)N[C@@H](Cc2ccccc2)C(=O)NNC(=O)[C@H](Cc2ccccc2)NC(=O)CNC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
