| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50022240 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54893 |
|---|
| IC50 | 1500±n/a nM |
|---|
| Citation |  DeGraw, JI; Colwell, WT; Kisliuk, RL; Gaumont, Y; Sirotnak, FM Synthesis and antifolate properties of 5,10-methylenetetrahydro-8,10-dideazaminopterin. J Med Chem29:1786-9 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_LACCA | dhfR | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18437.08 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | ChEMBL_1357878 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
|---|
| BDBM50022240 |
|---|
| n/a |
|---|
| Name | BDBM50022240 |
|---|
| Synonyms: | 2-[4-(7,9-Diamino-1,2,3,3a,4,5-hexahydro-6,8,9b-triaza-cyclopenta[a]naphthalen-2-yl)-benzoylamino]-pentanedioic acid | CHEMBL49022 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H26N6O5 |
|---|
| Mol. Mass. | 454.479 |
|---|
| SMILES | Nc1nc(N)c2N3CC(CC3CCc2n1)c1ccc(cc1)C(=O)NC(CCC(O)=O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
