Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGAR transformylase
LigandBDBM50022741
Substrate/Competitorn/a
Meas. Tech.ChEMBL_70036
IC50 80000±n/a nM
Citation Piper JRMcCaleb GSMontgomery JAKisliuk RLGaumont YThorndike JSirotnak FM Synthesis and antifolate activity of 5-methyl-5,10-dideaza analogues of aminopterin and folic acid and an alternative synthesis of 5,10-dideazatetrahydrofolic acid, a potent inhibitor of glycinamide ribonucleotide formyltransferase. J Med Chem 31:2164-9 (1988) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
GAR transformylase
Name:GAR transformylase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:107504.27
Organism:Mus musculus
Description:ChEMBL_497843
Residue:1010
Sequence:
MAARVLVIGSGGREHTLAWKLAQSPQVKQVLVAPGNAGTACAGKISNAAVSVNDHSALAQ
FCKDEKIELVVVGPEAPLAAGIVGDLTSAGVRCFGPTAQAAQLESSKKFAKEFMDRHEIP
TAQWRAFTNPEDACSFITSANFPALVVKASGLAAGKGVIVAKSQAEACRAVQEIMQEKSF
GAAGETVVVEEFLEGEEVSCLCFTDGKTVAEMPPAQDHKRLLDGDEGPNTGGMGAYCPAP
QVSKDLLVKIKNTILQRAVDGMQQEGAPYTGILYAGIMLTKDGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVMQSTLDGLLSASLPVWLENHSAVTVVMASKGYPGAYTKGVEITGFPEA
QALGLQVFHAGTALKDGKVVTSGGRVLTVTAVQENLMSALAEARKGLAALKFEGAIYRKD
IGFRAVAFLQRPRGLTYKDSGVDIAAGNMLVKKIQPLAKATSRPGCSVDLGGFAGLFDLK
AAGFKDPLLASGTDGVGTKLKIAQLCNKHDSIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLSTTEAVIAGIAAACQQAGCALLGGETAEMPNMYPPGEYDLAGFAVGAMERHQKLP
QLERITEGDAVIGVASSGLHSNGFSLVRKIVERSSLQYSSPAPGGCGDQTLGDLLLTPTR
IYSHSLLPIIRSGRVKAFAHITGGGLLENIPRVLPQKFGVDLDASTWRVPKVFSWLQQEG
ELSEEEMARTFNCGIGAALVVSKDQAEQVLHDVRRRQEEAWVIGSVVACPEDSPRVRVKN
LIETIQTNGSLVANGFLKSNFPVQQKKARVAVLISGTGSNLQALIDSTRDPKSSSHIVLV
ISNKAAVAGLDRAERAGIPTRVINHKLYKNRVEFDNAVDHVLEEFSVDIVCLAGFMRILS
GPFVRKWDGKMLNIHPSLLPSFKGSNAHEQVLEAGVTITGCTVHFVAEDVDAGQIILQEA
VPVRRGDTVATLSERVKVAEHKIFPAALQLVASGAVQLREDGKIHWAKEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022741
n/a
NameBDBM50022741
Synonyms:(5RS, 6RS) 2-{4-[2-(2-Amino-5-methyl-4-oxo-3,4,5,6,7,8-hexahydro-pyrido[2,3-d]pyrimidin-6-yl)-ethyl]-benzoylamino}-pentanedioic acid | CHEMBL66389
TypeSmall organic molecule
Emp. Form.C22H27N5O6
Mol. Mass.457.4797
SMILESCC1C(CCc2ccc(cc2)C(=O)NC(CCC(O)=O)C(O)=O)CNc2nc(N)[nH]c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: