| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor |
|---|
| Ligand | BDBM50460673 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1770029 (CHEMBL4222141) |
|---|
| Ki | 674±n/a nM |
|---|
| Citation |  Stachel, SJ; Egbertson, MS; Wai, J; Machacek, M; Toolan, DM; Swestock, J; Eddins, DM; Puri, V; McGaughey, G; Su, HP; Perlow, D; Wang, D; Ma, L; Parthasarathy, G; Reid, JC; Abeywickrema, PD; Smith, SM; Uslaner, JM Indole acids as a novel PDE2 inhibitor chemotype that demonstrate pro-cognitive activity in multiple species. Bioorg Med Chem Lett28:1122-1126 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor |
|---|
| Name: | Prostaglandin D2 receptor |
|---|
| Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40288.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13258 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
|---|
| BDBM50460673 |
|---|
| n/a |
|---|
| Name | BDBM50460673 |
|---|
| Synonyms: | CHEMBL4229054 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23F4NO4S |
|---|
| Mol. Mass. | 497.502 |
|---|
| SMILES | C[C@H](c1ccc(cc1)C(F)(F)F)n1c2[C@H](CC(O)=O)CCCc2c2cc(F)cc(c12)S(C)(=O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
