| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50023680 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_217876 |
|---|
| Ki | >0.004±n/a nM |
|---|
| Citation |  Su, TL; Huang, JT; Chou, TC; Otter, GM; Sirotnak, FM; Watanabe, KA Chemical synthesis and biological activities of 5-deazaaminopterin analogues bearing substituent(s) at the 5- and/or 7-position(s). J Med Chem31:1209-15 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50023680 |
|---|
| n/a |
|---|
| Name | BDBM50023680 |
|---|
| Synonyms: | 2-{4-[(2,4-Diamino-7-phenyl-pyrido[2,3-d]pyrimidin-6-ylmethyl)-amino]-benzoylamino}-pentanedioic acid | CHEMBL19914 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25N7O5 |
|---|
| Mol. Mass. | 515.5206 |
|---|
| SMILES | Nc1nc(N)c2cc(CNc3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)c(nc2n1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
