Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50023682 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_217876 |
---|
Ki | >0.004±n/a nM |
---|
Citation | Su, TL; Huang, JT; Chou, TC; Otter, GM; Sirotnak, FM; Watanabe, KA Chemical synthesis and biological activities of 5-deazaaminopterin analogues bearing substituent(s) at the 5- and/or 7-position(s). J Med Chem31:1209-15 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50023682 |
---|
n/a |
---|
Name | BDBM50023682 |
Synonyms: | 2-{4-[(2,4-Diamino-5-methyl-7-phenyl-pyrido[2,3-d]pyrimidin-6-ylmethyl)-amino]-benzoylamino}-pentanedioic acid | CHEMBL20423 |
Type | Small organic molecule |
Emp. Form. | C27H27N7O5 |
Mol. Mass. | 529.5472 |
SMILES | Cc1c(CNc2ccc(cc2)C(=O)NC(CCC(O)=O)C(O)=O)c(nc2nc(N)nc(N)c12)-c1ccccc1 |
Structure |
|