| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Large neutral amino acids transporter small subunit 1 |
|---|
| Ligand | BDBM50142500 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1777837 (CHEMBL4234829) |
|---|
| IC50 | 170000±n/a nM |
|---|
| Citation |  Chien, HC; Colas, C; Finke, K; Springer, S; Stoner, L; Zur, AA; Venteicher, B; Campbell, J; Hall, C; Flint, A; Augustyn, E; Hernandez, C; Heeren, N; Hansen, L; Anthony, A; Bauer, J; Fotiadis, D; Schlessinger, A; Giacomini, KM; Thomas, AA Reevaluating the Substrate Specificity of the L-Type Amino Acid Transporter (LAT1). J Med Chem61:7358-7373 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Large neutral amino acids transporter small subunit 1 |
|---|
| Name: | Large neutral amino acids transporter small subunit 1 |
|---|
| Synonyms: | 4F2 LC | 4F2 light chain | 4F2LC | CD98 light chain | CD98LC | CD98LC | Integral membrane protein E16 | L-type amino acid transporter 1 | LAT1 | LAT1_HUMAN | Large neutral amino acids transporter small subunit 1 | MPE16 | SLC7A5 | Solute carrier family 7 member 5 | hLAT1 | y+ system cationic amino acid transporter |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 55013.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_100160 |
|---|
| Residue: | 507 |
|---|
| Sequence: | MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIV
GTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM
LEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVL
LLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGDVSNLDPNFSFEGTKLDV
GNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTL
STEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLP
SILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRH
RKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKN
KPKWLLQGIFSTTVLCQKLMQVVPQET
|
|
|
|---|
| BDBM50142500 |
|---|
| n/a |
|---|
| Name | BDBM50142500 |
|---|
| Synonyms: | (2S)-2-amino-4-(methylsulfanyl)butanoic acid | (S)-2-amino-4-(methylthio)butanoic acid | (S)-2-amino-4-(methylthio)butyric acid | (S)-methionine | CHEMBL42336 | L-(-)-methionine | L-Methionin | L-alpha-amino-gamma-methylmercaptobutyric acid | L-methionine | US11021454, Compound L-met |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C5H11NO2S |
|---|
| Mol. Mass. | 149.211 |
|---|
| SMILES | CSCC[C@H](N)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
