| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytidine deaminase |
|---|
| Ligand | BDBM50025460 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_217550 |
|---|
| Ki | 6600±n/a nM |
|---|
| Citation |  Kelley, JA; Driscoll, JS; McCormack, JJ; Roth, JS; Marquez, VE Furanose-pyranose isomerization of reduced pyrimidine and cyclic urea ribosides. J Med Chem29:2351-8 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytidine deaminase |
|---|
| Name: | Cytidine deaminase |
|---|
| Synonyms: | CDD_MOUSE | Cda | Cdd | Cytidine aminohydrolase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16129.75 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_52531 |
|---|
| Residue: | 146 |
|---|
| Sequence: | MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACY
PLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFGTDWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIQ
|
|
|
|---|
| BDBM50025460 |
|---|
| n/a |
|---|
| Name | BDBM50025460 |
|---|
| Synonyms: | 1-(3,4,5-Trihydroxy-tetrahydro-pyran-2-yl)-[1,3]diazepan-2-one; compound with 1-(3,4-dihydroxy-5-hydroxymethyl-tetrahydro-furan-2-yl)-[1,3]diazepan-2-one | CHEMBL77547 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H18N2O5 |
|---|
| Mol. Mass. | 246.2603 |
|---|
| SMILES | O[C@@H]1CO[C@H]([C@H](O)[C@@H]1O)N1CCCCNC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
