| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50467711 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1796654 (CHEMBL4268771) |
|---|
| Ki | 29000±n/a nM |
|---|
| Citation |  Eng, WS; Rejman, D; Pohl, R; West, NP; Woods, K; Naesens, LMJ; Keough, DT; Guddat, LW Pyrrolidine nucleoside bisphosphonates as antituberculosis agents targeting hypoxanthine-guanine phosphoribosyltransferase. Eur J Med Chem159:10-22 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50467711 |
|---|
| n/a |
|---|
| Name | BDBM50467711 |
|---|
| Synonyms: | CHEMBL4283940 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H15N6O5P |
|---|
| Mol. Mass. | 330.2371 |
|---|
| SMILES | Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1CNC[C@@H]1OCP(O)(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
