| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50468679 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1800962 (CHEMBL4273254) |
|---|
| Ki | 47±n/a nM |
|---|
| Citation |  Estrada Valencia, M; Herrera-Arozamena, C; de Andrés, L; Pérez, C; Morales-García, JA; Pérez-Castillo, A; Ramos, E; Romero, A; Viña, D; Yáñez, M; Laurini, E; Pricl, S; Rodríguez-Franco, MI Neurogenic and neuroprotective donepezil-flavonoid hybrids with sigma-1 affinity and inhibition of key enzymes in Alzheimer's disease. Eur J Med Chem156:534-553 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50468679 |
|---|
| n/a |
|---|
| Name | BDBM50468679 |
|---|
| Synonyms: | CHEMBL4285912 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H27N3O3 |
|---|
| Mol. Mass. | 405.4895 |
|---|
| SMILES | Oc1cccc2c1[nH]c(cc2=O)C(=O)NCCC1CCN(Cc2ccccc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
