| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2C |
|---|
| Ligand | BDBM50321874 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2755 (CHEMBL617752) |
|---|
| Ki | 25±n/a nM |
|---|
| Citation |  Bromidge, SM; Dabbs, S; Davies, DT; Duckworth, DM; Forbes, IT; Ham, P; Jones, GE; King, FD; Saunders, DV; Starr, S; Thewlis, KM; Wyman, PA; Blaney, FE; Naylor, CB; Bailey, F; Blackburn, TP; Holland, V; Kennett, GA; Riley, GJ; Wood, MD Novel and selective 5-HT2C/2B receptor antagonists as potential anxiolytic agents: synthesis, quantitative structure-activity relationships, and molecular modeling of substituted 1-(3-pyridylcarbamoyl)indolines. J Med Chem41:1598-612 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 2C |
|---|
| Name: | 5-hydroxytryptamine receptor 2C |
|---|
| Synonyms: | 5-HT-1C | 5-HT-2C | 5-HT1C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 51836.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28335 |
|---|
| Residue: | 458 |
|---|
| Sequence: | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
|---|
| BDBM50321874 |
|---|
| n/a |
|---|
| Name | BDBM50321874 |
|---|
| Synonyms: | 4,5-Dichloro-2,3-dihydro-indole-1-carboxylic acid pyridin-3-ylamide | 4,5-dichloro-N-(pyridin-3-yl)indoline-1-carboxamide | CHEMBL289063 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11Cl2N3O |
|---|
| Mol. Mass. | 308.163 |
|---|
| SMILES | Clc1ccc2N(CCc2c1Cl)C(=O)Nc1cccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
