Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2C |
---|
Ligand | BDBM50321875 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2755 (CHEMBL617752) |
---|
Ki | 7.9±n/a nM |
---|
Citation | Bromidge, SM; Dabbs, S; Davies, DT; Duckworth, DM; Forbes, IT; Ham, P; Jones, GE; King, FD; Saunders, DV; Starr, S; Thewlis, KM; Wyman, PA; Blaney, FE; Naylor, CB; Bailey, F; Blackburn, TP; Holland, V; Kennett, GA; Riley, GJ; Wood, MD Novel and selective 5-HT2C/2B receptor antagonists as potential anxiolytic agents: synthesis, quantitative structure-activity relationships, and molecular modeling of substituted 1-(3-pyridylcarbamoyl)indolines. J Med Chem41:1598-612 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 2C |
---|
Name: | 5-hydroxytryptamine receptor 2C |
Synonyms: | 5-HT-1C | 5-HT-2C | 5-HT1C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 51836.79 |
Organism: | Homo sapiens (Human) |
Description: | P28335 |
Residue: | 458 |
Sequence: | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
BDBM50321875 |
---|
n/a |
---|
Name | BDBM50321875 |
Synonyms: | 5,6-Dichloro-2,3-dihydro-indole-1-carboxylic acid pyridin-3-ylamide | 5,6-dichloro-N-(pyridin-3-yl)indoline-1-carboxamide | CHEMBL297043 |
Type | Small organic molecule |
Emp. Form. | C14H11Cl2N3O |
Mol. Mass. | 308.163 |
SMILES | Clc1cc2CCN(C(=O)Nc3cccnc3)c2cc1Cl |
Structure |
|