Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1D |
---|
Ligand | BDBM50005835 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1743 (CHEMBL616948) |
---|
IC50 | 3.0±n/a nM |
---|
Citation | Jandu, KS; Barrett, V; Brockwell, M; Cambridge, D; Farrant, DR; Foster, C; Giles, H; Glen, RC; Hill, AP; Hobbs, H; Honey, A; Martin, GR; Salmon, J; Smith, D; Woollard, P; Selwood, DL Discovery of 4-[3-(trans-3-dimethylaminocyclobutyl)-1H-indol-5-ylmethyl]-(4S)-oxazolidin-2-one (4991W93), a 5HT(1B/1D) receptor partial agonist and a potent inhibitor of electrically induced plasma extravasation. J Med Chem44:681-93 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1D |
---|
Name: | 5-hydroxytryptamine receptor 1D |
Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41920.63 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
Residue: | 377 |
Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
BDBM50005835 |
---|
n/a |
---|
Name | BDBM50005835 |
Synonyms: | (3-[2-(dimethylamino)ethyl]-1H-indol-5-yl)-N-methylmethanesulfonamide | 1-[3-(2-dimethylaminoethyl)-1H-indol-5-yl]-N-methyl-methanesulfonamide | 1-{3-[2-(dimethylamino)ethyl]-1H-indol-5-yl}-N-methylmethanesulfonamide | 3-(2-(dimethylamino)ethyl)-N-methyl-1H-indole-5-methanesulfonamide | 3-[2-(dimethylamino)ethyl]-N-methylindole-5-methanesulfonamide | CHEMBL128 | SUMATRIPTAN | Sumatran | Sumax |
Type | Small organic molecule |
Emp. Form. | C14H21N3O2S |
Mol. Mass. | 295.4 |
SMILES | CNS(=O)(=O)Cc1ccc2[nH]cc(CCN(C)C)c2c1 |
Structure |
|