| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1B |
|---|
| Ligand | BDBM50473521 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1371 (CHEMBL616444) |
|---|
| IC50 | 14±n/a nM |
|---|
| Citation |  Jandu, KS; Barrett, V; Brockwell, M; Cambridge, D; Farrant, DR; Foster, C; Giles, H; Glen, RC; Hill, AP; Hobbs, H; Honey, A; Martin, GR; Salmon, J; Smith, D; Woollard, P; Selwood, DL Discovery of 4-[3-(trans-3-dimethylaminocyclobutyl)-1H-indol-5-ylmethyl]-(4S)-oxazolidin-2-one (4991W93), a 5HT(1B/1D) receptor partial agonist and a potent inhibitor of electrically induced plasma extravasation. J Med Chem44:681-93 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1B |
|---|
| Name: | 5-hydroxytryptamine receptor 1B |
|---|
| Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 43579.17 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
|---|
| Residue: | 390 |
|---|
| Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
|---|
| BDBM50473521 |
|---|
| n/a |
|---|
| Name | BDBM50473521 |
|---|
| Synonyms: | CHEMBL159332 | CP-122288 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H23N3O2S |
|---|
| Mol. Mass. | 321.438 |
|---|
| SMILES | [H][C@]1(Cc2c[nH]c3ccc(CS(=O)(=O)NC)cc23)CCCN1C |
|---|
| Structure | 
|
|---|
Search and Browse
