| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM50063917 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_207459 (CHEMBL817439) |
|---|
| IC50 | 1001±n/a nM |
|---|
| Citation |  Kottirsch, G; Koch, G; Feifel, R; Neumann, U Beta-aryl-succinic acid hydroxamates as dual inhibitors of matrix metalloproteinases and tumor necrosis factor alpha converting enzyme. J Med Chem45:2289-93 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM50063917 |
|---|
| n/a |
|---|
| Name | BDBM50063917 |
|---|
| Synonyms: | (2S,3R)-N(4)-[(2S)-3,3-dimethyl-1-(methylamino)-1-oxobutan-2-yl]-N(1),2-dihydroxy-3-(2-methylpropyl)butanediamide | CHEMBL279785 | cid_119031 | marimastat |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H29N3O5 |
|---|
| Mol. Mass. | 331.4079 |
|---|
| SMILES | CNC(=O)[C@@H](NC(=O)[C@H](CC(C)C)[C@H](O)C(=O)NO)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
