| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50027972 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54924 |
|---|
| Ki | 0.600000±n/a nM |
|---|
| Citation |  Birdsall, B; Feeney, J; Pascual, C; Roberts, GC; Kompis, I; Then, RL; Müller, K; Kroehn, A A 1H NMR study of the interactions and conformations of rationally designed brodimoprim analogues in complexes with Lactobacillus casei dihydrofolate reductase. J Med Chem27:1672-6 (1985) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_LACCA | dhfR | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18437.08 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | ChEMBL_1357878 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
|---|
| BDBM50027972 |
|---|
| n/a |
|---|
| Name | BDBM50027972 |
|---|
| Synonyms: | 7-[2-Bromo-5-(2,4-diamino-pyrimidin-5-ylmethyl)-3-methoxy-phenoxy]-heptanoic acid | CHEMBL31713 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25BrN4O4 |
|---|
| Mol. Mass. | 453.33 |
|---|
| SMILES | COc1cc(Cc2cnc(N)nc2N)cc(OCCCCCCC(O)=O)c1Br |
|---|
| Structure | 
|
|---|
Search and Browse
