| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nociceptin receptor |
|---|
| Ligand | BDBM50478180 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_471599 (CHEMBL940230) |
|---|
| Ki | 4.2±n/a nM |
|---|
| Citation |  Palin, R; Clark, JK; Evans, L; Houghton, AK; Jones, PS; Prosser, A; Wishart, G; Yoshiizumi, K Structure-activity relationships and CoMFA of N-3 substituted phenoxypropyl piperidine benzimidazol-2-one analogues as NOP receptor agonists with analgesic properties. Bioorg Med Chem16:2829-51 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nociceptin receptor |
|---|
| Name: | Nociceptin receptor |
|---|
| Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40702.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41146 |
|---|
| Residue: | 370 |
|---|
| Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
|---|
| BDBM50478180 |
|---|
| n/a |
|---|
| Name | BDBM50478180 |
|---|
| Synonyms: | CHEMBL260784 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H39N5O3 |
|---|
| Mol. Mass. | 517.6624 |
|---|
| SMILES | COc1ccc(C)c(OC(CCN2CCC(CC2)n2c3ccccc3n(Cn3ccnc3)c2=O)C(C)C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
