Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase protein |
---|
Ligand | BDBM50138406 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_583932 (CHEMBL1061783) |
---|
Kd | 9800±n/a nM |
---|
Citation | Zelina, S; Sheen, CW; Radzio, J; Mellors, JW; Sluis-Cremer, N Mechanisms by which the G333D mutation in human immunodeficiency virus type 1 Reverse transcriptase facilitates dual resistance to zidovudine and lamivudine. Antimicrob Agents Chemother52:157-63 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase protein |
---|
Name: | Reverse transcriptase protein |
Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
Type: | Protein |
Mol. Mass.: | 30203.56 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WJQ2 |
Residue: | 259 |
Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
BDBM50138406 |
---|
n/a |
---|
Name | BDBM50138406 |
Synonyms: | 3TC Triphosphate | CHEMBL1230 | LAMIVUDINE | Lamivudine triphosphate | [(2R,5S)-5-(4-amino-2-oxopyrimidin-1(2H)-yl)-1,3-oxathiolan-2-yl]methyl tetrahydrogen triphosphate | [[[5-(4-amino-2-oxo-1H-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxyphosphonic acid |
Type | Small organic molecule |
Emp. Form. | C8H14N3O12P3S |
Mol. Mass. | 469.196 |
SMILES | Nc1ccn([C@@H]2CS[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O2)c(=O)n1 |r| |
Structure |
|