| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50483778 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_744494 (CHEMBL1772515) |
|---|
| IC50 | >300000±n/a nM |
|---|
| Citation |  Vandurm, P; Guiguen, A; Cauvin, C; Georges, B; Le Van, K; Michaux, C; Cardona, C; Mbemba, G; Mouscadet, JF; Hevesi, L; Van Lint, C; Wouters, J Synthesis, biological evaluation and molecular modeling studies of quinolonyl diketo acid derivatives: new structural insight into the HIV-1 integrase inhibition. Eur J Med Chem46:1749-56 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50483778 |
|---|
| n/a |
|---|
| Name | BDBM50483778 |
|---|
| Synonyms: | CHEMBL1770427 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H23F2NO6 |
|---|
| Mol. Mass. | 519.4928 |
|---|
| SMILES | CCOC(=O)C(\O)=C\C(=O)c1cn(Cc2ccc(F)cc2)c2ccc(OCc3ccc(F)cc3)cc2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
