Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50484345 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_772987 (CHEMBL1837906) |
---|
Ki | 19±n/a nM |
---|
Citation | Ganguly, AK; Alluri, SS; Caroccia, D; Biswas, D; Wang, CH; Kang, E; Zhang, Y; McPhail, AT; Carroll, SS; Burlein, C; Munshi, V; Orth, P; Strickland, C Design, synthesis, and X-ray crystallographic analysis of a novel class of HIV-1 protease inhibitors. J Med Chem54:7176-83 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50484345 |
---|
n/a |
---|
Name | BDBM50484345 |
Synonyms: | CHEMBL1835926 |
Type | Small organic molecule |
Emp. Form. | C26H36N2O6S |
Mol. Mass. | 504.639 |
SMILES | COc1ccc2c(C[C@H](C)CN(C[C@@H](O)[C@H](Cc3ccccc3)NC(=O)OC(C)(C)C)S2(=O)=O)c1 |r| |
Structure |
|